10dB, 20db EDFA Multi-Channel enkanalig få Block Fiber Edfa Raman optisk ingång förstärkare

10dB, 20db EDFA Multi-Channel enkanalig få Block Fiber Edfa Raman optisk ingång förstärkare

Produktbeskrivning SP5100 serie är en CATV booster optiska förstärkare med vinst spektrumbandet inom 1540 ~ 1565nm.

SP5100seriesisaCATVboosteropticalamplifierwithgainspectrumbandwithin1540 ~ 1565nm. Thiskindofopticalamplifierisdesignedfortheapplicationofsinglechannelor1~8continuousribbonchannels(ITUwavelength). Generally,fiberCATVsystemoperatesinsinglewavelengththathasnostrictrequirementongainflatness.HA5100 boosteramplifierisfeaturedwithlowNF, hög saturatedoutputpower. Itisapplicableforcentralbureau, sub-bureauandlinerelay, aswellasotheropticalcommunicationnetwork. HA5100isappliedmostcommonlyandwidelycomparedwithotheropticalamplifierinCATVsystem.
sopoisthefamousmanufacturerofopticalamplifier. HA5100opticalamplifieradoptstheworldand#39;stopclasspumplaserandAmericaOFSerbium-dopedopticalfiber.PerfectAPC,ACCandATCcontrol,excellentdesignintheventilationandheat-dissipationensurethelonglifeandhighreliableworkofpumplaser. RS232andRJ45offerserialcommutationandSNMPnetworkmanagementport.TheLCDatthefrontpanelofferstheworkindexofallequipmentandwarningalarm.Thelaserwillswitchoffautomaticallyifopticalpowerismissing,whichofferssecurityprotectionforthelaser. Alltheopticalportofopticalamplifiercanbeinstalledinthefrontpanel(alsocanbeinthebackpanelifcustomersspecify).
Sopo produkt, foritshighquality, highreliableandhighcostperformance, istheidealchoiceofthesystemintegrationandsystemoperation.
1540 ~ 1563nmoperatingwavelength
Lownoise, hög, Högtillförlitlighet
Threeexterioroption:1U(19"Stander), 3D (12,4", 3U, Desk-typ) andmodulator
1Uand3Dexterior, offeringstatusappearanceanddiagnosingfaultwithLCD, standardRS232communicationinterface, SNMPnetworkmanagementfunction
DBSandamp; MMDS
255KmPAL-D/56CHandamp; 20CHDigitalQAMHybridTransmissionApplicationCases
TheapplicationofHA5100insatelliteL-Bandlong-distance(816Km) fibertransmission


EDFA Multi-Channel vinst block optiska förstärkare är speciellt utformad för att möta lågt brus och vinna planhet kraven i

tät våglängd division multiplexing system. (DWDM-system). Den finns i flera typer för kunderna att välja från,

inklusive booster förstärkare, line förstärkare och pre-förstärkare. Eftersom den optiska förstärkare isTelcordia GR-1312-CORE kvalificerade och

RoHS-kompatibel, kunder kan känna trygghet i att köpa den.


1. hög output power, stor tillförlitlighet

2. liten storlek, enkel installation

3. bred operativa våglängdsområdet

SopofiberismultichannelopticalamplifiermanufacturerinChina, weoffermultichannelopticalamplifier, andopticalperformance

övervaka,portablePONopticalpowermeter, wesupplyhighqualitywithcompetitiveprice, ourcompanyisbasedonChina,

hela kedjan av manufacturingmini optisk switch, single-mode bredband träd fiber koppling kan slutföras i Kina, även i en stad.

Lägre tillverkningskostnad sparar din inköp kostnad. Mer information om varje produkten visas sidan med beskrivning.

Raman optiska förstärkare är speciellt utformad för långdistansflygningar optisk transmissionssystem.

Det kan direkt förstärka de optiska signalerna av C-bandet, L- och C L-banden och kraftigt förbättra

optisk signal-brus-förhållande (OSNR), vilket förbättrar transmission prestanda av systemet.

Den optiska förstärkaren kan uppgradera det befintliga systemet till 10Gb/s eller 40Gb/s. Ytterligare

Det är Telcordia GR-1312-CORE kvalificerade och RoHS-kompatibel, vilket ger kunderna fullständig sinnesro.

1. kompakt struktur, låg strömförbrukning
2. hög vinna, bra vinna planhet
3. högpresterande pump laser och passiv enhet

Sopofiber Raman optiska förstärkare tillverkaren i Kina erbjuder vi Raman optiska förstärkare,

och OEO converter, transportabel rörlig optiska dämpare, vi levererar hög kvalitet med konkurrenskraftiga priser,

vårt företag är baserat på Kina, hela kedjan av tillverkning elektriska variabel optiska dämpare,

single-mode bredband fiber koppling kan slutföras i Kina, även i en stad.

Lägre tillverkningskostnad sparar din inköp kostnad.

Mer information om varje produkten visas sidan med beskrivning

EDFA-MW/GW-VGA optiska förstärkare är speciellt utformad för DWDM överföringssystemet.

EDFA-MW är optoelektroniska integrerade modul och EDFA-GW är ren optisk modul.

Sopofiber optiska förstärkare är Telcordia GR-1312-CORE kvalificerade och RoHS-kompatibel,

Kunder kan känna trygghet i att använda.

1. justerbar förstärkning design gör den optiska förstärkaren att flexibelt rymma ett brett utbud av driftsförhållanden
2. mitten av scenen tillgång för DCM, OADM
3. hög output power, låg brusfaktor
4. stödja ACC eller AGC-läge
5. standard RS232 kommunikationsgränssnitt
6. hög kontroll noggrannhet, bra transientsvar kännetecken
7. stor tillförlitlighet, låg strömförbrukning

Sopofiber EDFA - VGA optiska förstärkare tillverkaren i Kina erbjuder vi EDFA - VGA optiska förstärkare,

och MEMS dämparen array module, speciell våglängd redskapsfäste, vi levererar hög kvalitet med konkurrenskraftiga priser,

vårt företag är baserat på Kina, hela kedjan av tillverkning DWDM OEO omvandlare, Multi-Channel FBG DCM

modulen kan slutföras i Kina, även i en stad. Lägre tillverkningskostnad sparar din inköp kostnad.

Mer information om varje produkten visas sidan med beskrivning.

EDFA-TV optiska förstärkare är speciellt konstruerade och tillverkade för CATV system.Det installeras bakom den optiska

sändare att öka uteffekten för sändaren ochförlänga det signal överföringsavståndet.

Den optiska förstärkaren är Telcordia GR-1312-COREkvalificerade och RoHS godkänd.

1. hög output power, låg brusfaktor
2. wide verksamma våglängdsområdet, som omfattar hela C-bandet
3. stor tillförlitlighet
4. flexibel övervakning gränssnitt
5. standard CATV rack, lätt att installera och underhålla

EDFA-TV optiska förstärkare är lämplig för analoga CATV nätverk och optisk fiber distributionsnät.
Sopofiber optiska förstärkare tillverkaren i Kina erbjuder vi optiska förstärkare, och manuell variabla optiska dämpare,

PLC splitter, vi leverera hög kvalitet till konkurrenskraftiga priser, vårt företag är baserat på Kina,

hela kedjan av tillverkning optisk linje monitor, Multi-Channel FBG DCM modul kan slutföras i Kina,

även i en stad. Lägre tillverkningskostnad sparar din inköp kostnad. Mer information om varje produkten

visas sidan med beskrivning.

EDFA-PA optiska förstärkare är en låg brusförstärkning som är speciellt utformad för enda kanal optiskaöverföringssystemet.

Det installeras innan mottagaren för att förbättra mottagarens känslighet och förlänga signalen överföringsavståndet.

Eftersom den optiska förstärkaren är Telcordia GR-1312-CORE kvalificerade och uppfyller RoHS-kraven,

Kunder kan känna sig hemmastadda i sitt köp.

1. hög optisk förstärkning, låg brusfaktor, bra ASE hämning funktion
2. hög tillförlitlighet, konkurrenskraftigt pris
3. flexibel övervakning gränssnitt
4. bred operativa våglängdsområdet
5. nätverksövervakning tillgängliga
6. standard rack för enkel installation och underhåll

EDFA-PA optiska förstärkare används ofta för metropolitan area network, nätverk access,
fjärrtransporter nätverk,

och olika typer av SDH/PDH överföringssystem. Accelink är optisk förstärkaretillverkare i Kina,

Vi erbjuder optiska förstärkare, och fasta optiska dämpare,speciell våglängd redskapsfäste,Vi levererar hög kvalitet med

konkurrenskraftigt pris,vårt företag är baserat på Kina,hela kedjan av tillverkning enda kanal FBG DCM modul,

optisk linje, utrustning protector kan slutföras i Kina, även i en stad. Lägre tillverkningkostnad sparar

dina inköp kostnader.Mer information om varje produkten visas sidan med beskrivning.

EDFA-LA optiska förstärkare är en linje förstärkare specialdesignad för enda kanal optisk transmissionssystem.

Installerat i kraftledningen, den optiska förstärkaren kan kompensera optiska strömavbrott och förlänga den

signalen överföringsavståndet. Detta gör det det perfekta valet för att ersätta konventionella O-E-O regenerator.

Dessutom, den optiska förstärkaren är Telcordia GR-1312-CORE kvalificerade och RoHS-kompatibel, så snälla känsla

säkra i att köpa den.

1. EDFA-LA optiska förstärkare är mer lönsamma och pålitlig än liknande produkter.
2. användarvänlighet, låg ljudnivå
3. flexibel övervakning gränssnitt
4. nätverksövervakning tillgängliga
5. standard rack, lätt att installera och underhålla

Sopofiber optiska förstärkare är bra för långdistansflygningar nätverk, metropolitan area network, nätverk access,

samt olika SDH/PDH överföringssystem.

Sopofiber optiska förstärkare tillverkaren i Kina erbjuder vi optiska förstärkare, och mini optisk switch,

single-mode bredband träd fiber redskapsfäste, vi levererar hög kvalitet med konkurrenskraftiga priser, vårt företag

baseras på Kina, hela kedjan av tillverkning TRYCK PD, TRYCK PD array module, optisk Prestandaövervakaren

kan slutföras i Kina, även i en stad. Lägre tillverkningskostnad sparar din inköp kostnad.

Mer information om varje produkten visas sidan med beskrivning

EDFA-BA optiska förstärkare är en booster förstärkare specialdesignad för enda kanal optisk transmissionssystem.

Det installeras bakom optiska sändaren att öka uteffekten för sändaren och förlänga signalen

överföringsavstånd. Den optiska förstärkaren är Telcordia GR-1312-CORE kvalificerade och uppfyller RoHS.

På grund av vår konsekventa satsning på produktförbättringar har Sopofiber optiska förstärkare många fördelar, såsom
1. hög output power, låg brusfaktor
2. wide verksamma våglängdsområdet, som omfattar hela C-bandet
3. komplett och flexibel övervakning gränssnitt
4. oberoende nätverksövervakning tillgängliga
5. hög tillförlitlighet
6. standard rack, lätt att installera och underhålla

EDFA-BA optiska förstärkare är lämplig för långdistansflygningar nätverk, metropolitan area network, nätverk access, samt olika SDH/PDH överföringssystem.
Sopofiber är optiska förstärkare tillverkaren i Kina, vi erbjuder optiska förstärkare, och optisk switch, single-mode bredband fiber koppling, vi levererar hög kvalitet till konkurrenskraftiga priser, vårt företag är baserat på Kina, hela kedjan av tillverkning koaxial PD, koaxial PD array module, flerkanaliga optiska kraftmätare kan slutföras i Kina, även i en stad. Lägre tillverkningskostnad sparar din inköp kostnad. Mer information om varje produkten visas sidan med beskrivning.

EDFA enda kanal vinst modul optiska förstärkare är speciellt utformad för C-bandet enda kanal optisk transmissionssystem.

Den optiska förstärkaren finns i flera typer. EDFA-MD är den allmänna typ och EDFA-MC är kompakt typ. Modulen kan

användas för att göra EDFA kort eller rack mount, enligt customerand #39; s specifika krav.

Sopofiber enda kanal vinst modul optiska förstärkare är Telcordia GR-1312-CORE kvalificerade och RoHS-kompatibel. Eftersom det är tillförlitliga,

lätt att installera och levereras med flexibel övervakning gränssnitt, det används alltmer i långdistansflygningar network, huvudstadsregionen nätverk,

tillgång till nätverk, samt olika SDH/PDH överföringssystem.

Sopofiber optiska förstärkare tillverkaren i Kina erbjuder vi optiska förstärkare, och elektriska variabel optiska dämpare,

single-mode bredband fiber redskapsfäste, vi leverera hög kvalitet till konkurrenskraftiga priser, vårt företag är baserat på Kina,

hela kedjan av tillverkning OEO converter, spridning ersättning fiber modul kan slutföras i Kina,

även i en stad. Lägre tillverkningskostnaden sparardina inköp kostnader.

Mer information om varje produkten visas sidan med beskrivning.


thisproductcanbedividedintoboosteramplifier, lineamplifierandpreamplifier.

Yearsoffocusonproductimprovementhasresultedintheopticalamplifierhavingmanyadvantages, suchascompactstructure,

highoutputpower, lownoiseandgreatreliability. Asaresult, SopofiberopticalamplifierisTelcordiaGR1312CORE, RoHSqualified,



EDFAsinglechannelgainblockopticalamplifieriswidelyappliedinmetropolitanareanetwork, accessnetworkandCATVsystem,


SopofiberissinglechannelopticalamplifiermanufacturerinChina, weoffersinglechannelopticalamplifier, andmultichannelopticalpowermeter,opticalpowermeter,wesupplyhighqualitywithcompetitiveprice, ourcompanyisbasedonChina, fullchainofmanufacturingopticalswitch,

singlemodebroadbandfibercouplercanbecompletedinChina, eveninonecity. Lowermanufacturingcostsavesyourpurchasingcost.


EDFA L-bandet vinst modul optiska förstärkare är speciellt utformad för att möta L-Band DWDMand #39; s krav när det gäller brett band,

låg ljudnivå, planhet och tjäna lås. Den innehåller booster förstärkare, line förstärkare och pre-förstärkare. Modulen kan användas för att

gör EDFA kort eller rack mount. Eftersom produkten är Telcordia GR-1312-CORE kvalificerade och RoHS-kompatibel, kan kunder känna

säkra i sitt köp.

Med funktioner för flexibel övervakning gränssnitt, kompakt storlek och enkel installation, EDFA L-bandet få modul optisk förstärkare

används ofta i L-sätter band optisk transmission och L-bandet DWDM system.

Sopofiber optiska förstärkare tillverkaren i Kina erbjuder vi optiska förstärkare, och optisk linje/utrustning beskyddare, optisk ljuskälla,

Vi levererar hög kvalitet till konkurrenskraftiga priser, vårt företag är baserat på Kina, hela kedjan av tillverkning fast optisk dämpare,

speciell våglängd koppel kan slutföras i Kina, även i en stad.

Lägre tillverkningskostnad sparar din inköp kostnad. Mer information om varje produkten visas sidan med beskrivning.

10 dBm utdata enda kanal Booster EDFA optiska förstärkare för SDH-nätverk
SDH-EDFA-BA-O6 booster förstärkare designad för synkron Digital hierarki (SDH) program som installerats efter den optisk sändaren att öka överföringsavstånd för enda våglängd optisk modulsystem. Enheten har bred ingång effektområde från - 10dBm till + 6dBm, uteffekt upp till 10dBm och låg brusfaktor. Den innehåller också RS-232 datorgränssnitt.

Denna kan monteras i Rack-förstärkare fungerar som standard i konstant signal-förhöjningsfunktionen, men de kan konfigureras att konstant totalt uteffekt mode. Dessa enheter används i lång-drag överföring tillämpningar, särskilt för PDH, SDH, SONET och optiska Ethernet-överföring ansökan. Dess enkel användning och prestanda gör den SDH-EDFA-BA-xx-serien den idealiska lösningen för åtkomst och tunnelbana optiskt nätverk.

• Service som en booster förstärkare C-bandet 1550nm
• Avstämbara uteffekt: 10dBm
• Bred ingång effektområde: -10 ~ + 6dBm
• Låg Manne figur: typisk isandlt; 4.5dB
• Kontakter: SC/UPC, SC/APC, FC/UPC, FC/APC, LC/UPC, LC/APC, ST/UPC och ST/APC kopplingar finns
• Enkel eller dubbel 110VAC, 220VAC, - 48VDC eller 100V-240V strömförsörjning
• Seriella gränssnittet kommer med RS232, RS485
• 1U 19andquot; rack mount struktur för enkel installation
• Alla prestanda kompatibel med BellcoreGR-1312-CORE begära
• Använd för åtkomst och tunnelbana optiskt nätverk
• Fungerar med point-to-point-program
• Hög stabilitet och tillförlitlighet
• 3 års garanti
• 10 års livslängd
• OEM är tillgänglig
• Hot Swap Network Management Agent
• SNMP management nätverksgränssnitt: RJ45
• Stödja Telnet för tillval
• ASE buller filter andamp; ASE dämpning filter
• Hög exakt ACC (automatisk konstant ström) krets som standard, om du behöver andra krets, kontakta på sales@fiberstore.com
• ATC (automatisk temperaturreglering) funktion
• Erbjuda status utseende och diagnostisera fel med LCD
Mekanisk konstruktion

Struktur exempel

Den SDH EDFA från Fiberstore inklusive 1 + 2 + 3.








Drift våglängd






Mättad uteffekt (1)




Tillförd effekt (2)














Inmatade isolering




Utdata isolering




Ingång pumpen läckage




Utgång pump läckage





Returnera förlust




Polarisering beroende av vinst












Temperatur vid förvaring




Luftfuktighet (3)




Effekt spänning










Seriellt gränssnitt

RS232, RS485


110VAC, 220 VAC, - 48VDC eller 100V-240V


Simplex SC/UPC, SC/APC, FC/UPC, FC/APC, LC/UPC, LC/APC, ST/UPC och ST/APC tillgängliga


3 år

(1): kunden tillval
(2): förförstärkare: ineffekt – 35 ~-25dBm; Inline-förstärkare: ineffekt – 25 ~-10dBm, Booster: ineffekt – 10 ~ + 6dBm
(3): ingen kondens

Få 20dB Single Channel förförstärkare EDFA optiska förstärkare för SDH-nätverk
SDH-EDFA-PA-G20 förförstärkare utformad för synkron Digital hierarki (SDH) program är enda kanal EDFA som installeras innan mottagaren att förbättra mottagande känslighet och förlänga signalen överföringsavståndet. Enheten har bred ingång effektområde från - 35dBm till - 25dBm, 20dB gain och låg brusfaktor. Den innehåller också RS-232 datorgränssnitt.

Denna kan monteras i Rack-förstärkare fungerar som standard i konstant signal-förhöjningsfunktionen, men de kan konfigureras att konstant totalt uteffekt mode. Dessa enheter används i lång-drag överföring tillämpningar, särskilt för PDH, SDH, SONET och optiska Ethernet-överföring ansökan. Dess enkel användning och prestanda gör den SDH-EDFA-PA-xx-serien den idealiska lösningen för åtkomst och tunnelbana optiskt nätverk.
• Service som en förförstärkare C-bandet 1550nm
• Förstärkning: 20 dB
• Bred ingång effektområde:-35dBm till - 25dBm
• Låg Manne figur: typisk isandlt; 4.5dB
• Kontakter: SC/UPC, SC/APC, FC/UPC, FC/APC, LC/UPC, LC/APC, ST/UPC och ST/APC kopplingar finns
• Enkel eller dubbel 110VAC, 220VAC, - 48VDC eller 100V-240V strömförsörjning
• Seriella gränssnittet kommer med RS232, RS485
• 1U 19andquot; rack mount struktur för enkel installation
• Alla prestanda kompatibel med BellcoreGR-1312-CORE begära
• Använd för åtkomst och tunnelbana optiskt nätverk
• Fungerar med point-to-point-program
• Hög stabilitet och tillförlitlighet
• 3 års garanti
• 10 års livslängd
• OEM är tillgänglig
• Hot Swap Network Management Agent
• SNMP management nätverksgränssnitt: RJ45
• Stödja Telnet för tillval
• ASE buller filter andamp; ASE dämpning filter
• Hög exakt ACC (automatisk konstant ström) krets som standard, om du behöver andra krets, kontakta på sales@fiberstore.com
• ATC (automatisk temperaturreglering) funktion
• Erbjuda status utseende och diagnostisera fel med LCD
Mekanisk konstruktion

Struktur exempel

Den SDH EDFA från Fiberstore inklusive 1 + 2 + 3.








Drift våglängd






Mättad uteffekt (1)




Tillförd effekt (2)














Inmatade isolering




Utdata isolering




Ingång pumpen läckage




Utgång pump läckage





Returnera förlust




Polarisering beroende av vinst












Temperatur vid förvaring




Luftfuktighet (3)




Effekt spänning










Seriellt gränssnitt

RS232, RS485


110VAC, 220 VAC, - 48VDC eller 100V-240V


Simplex SC/UPC, SC/APC, FC/UPC, FC/APC, LC/UPC, LC/APC, ST/UPC och ST/APC tillgängliga


3 år

(1): kunden tillval
(2): förförstärkare: ineffekt – 35 ~-25dBm; Inline-förstärkare: ineffekt – 25 ~-10dBm, Booster: ineffekt – 10 ~ + 6dBm
(3): ingen kondens



EDFA-MWisthegeneraltypeandEDFA-MCisthecompacttype.Accordingtocustomerand #39; srequirements, themodulecanbeused


Featuringsmallsize, lownoise, easyinstallationandhighreliability, EDFAmulti-channelgainmoduleopticalamplifierisTelcordia

GR-1312-CORE, RoHSqualified, andisincreasinglyusedinDWDM, METROsystems.

SopofiberissinglechannelopticalamplifiermanufacturerinChina, weoffersinglechannelopticalamplifier, andMEMSvariable

opticalattenuator, singlemodebroadbandtreefibercoupler, wesupplyhighqualitywithcompetitiveprice, ourcompanyisbased

onChina, fullchainofmanufacturingbidirectionalOEOconverter, singlechannelFBGDCMmodulecanbecompletedinChina,

eveninonecity. Lowermanufacturingcostsavesyourpurchasingcost.


Sopofiber höga optiska förstärkare är en produkt avsedd för FTTH/CATV optisk access applikationer.
Tack vare användningen av Sopofiber klädda-pumpade Er-Yb Co dopade fiber förstärkare teknik, dess uteffekt kan vara upp till 33 dBm.

1. Wideoperatingwavelengthrange
2.Lownoise, convenientinstallationandmaintenance
3.Standard2Urackmount, multipleoutputlevels
4. Flexiblemonitoringinterface


SopofiberishighpoweropticalamplifiermanufacturerinChina, weofferhighpoweropticalamplifier, andbidirectionalOEO

omvandlare,benchtopdigitalvariableopticalattenuator, wesupplyhighqualitywithcompetitiveprice,ourcompanyisbased

onChina, fullchainofmanufacturingMEMSvariableopticalattenuator, singlemodebroadbandtreefibercouplercanbe

completedinChina, eveninonecity. Lowermanufacturingcostsavesyourpurchasingcost.Themoredetailsofeachproduct


Hävstångseffekt på bred erfarenhet och kompetens, SOPO är välkänd som en av de största tillverkarna av 10db, 20db edfa Multi-Channel enkanalig vinst block fiber edfa raman optisk ingång förstärkare för sin höga kvalitet och lågt pris produkter och utmärkt service. Observera att gratis att köpa billiga produkter tillverkade i Kina från vår fabrik.

Hot Tags: 10dB, 20db edfa Multi-Channel enkanalig få block fiber edfa raman optisk ingång förstärkare tillverkare, fabriken, gjort i Kina, kvalitet, lågt pris, Billigt
Relaterade produkter
Kontakta oss
SOPO Optical Communication Co., Ltd

Adress: JinDiDa Industry Zone, Langkou Industry Pak, Dalang Street, Longhua New District, Shenzhen, Kina

Telefon: +86-755-23124132

Fax: 86-755-23774378

E-post: 18818523155@163.com

SOPO Optical Communication Co., Ltd